PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000143173
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TALE
Protein Properties Length: 692aa    MW: 77474.3 Da    PI: 6.8675
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000143173genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox15.33.5e-054424841954
                    HHH..SSS--HHHHHHHHHHCTS-HHH.....HHHHHHHHHHH CS
       Homeobox  19 Fek..nrypsaeereeLAkklgLterq.....VkvWFqNrRak 54 
                    Fe   ++yps  ++  LA+++gL+ +q     V++WF N R +
  MDP0000143173 442 FEHflHPYPSDVDKHILARQTGLSRSQapynnVSNWFINARVR 484
                    554459***************88765433333*********88 PP

2BELL1123.2e-36304374272
           BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                    + elqk+k++Lls+leeV++rYk+y++q+++v++sFeavag g+a++Y +lA ka+SrhFr+Lkd i++qi
  MDP0000143173 304 FVELQKRKTRLLSMLEEVERRYKHYCDQMKAVVASFEAVAGAGAATVYSALAAKAMSRHFRSLKDGIVSQI 374
                    679*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.9E-58233372IPR006563POX domain
PfamPF075261.3E-47239370IPR006563POX domain
PROSITE profilePS500719.394420488IPR001356Homeobox domain
SMARTSM003892.1E-5423492IPR001356Homeobox domain
CDDcd000866.61E-9423489No hitNo description
SuperFamilySSF466892.61E-13424495IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-25426495IPR009057Homeodomain-like
PfamPF059201.2E-15440484IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MAGELLSSEA NKSRNNMASS SVGGFCYSYD VSSSNPTTTH FTTNQIQDFG SNPAEIFNLT  60
TGMEMIGFPK QQNDTSNPSA SSIWNKARFF GKQQQQQPDF TTGVSETSTD HHHQNNLLVG  120
GPPHHHHQQS NGWQENNNNN NRFPVDDSSL RCVFPCEGNE RPSQGLSLSL SSNNPSSIGL  180
QSFELKQTSH HQPPQHQDHQ DDGEDDHMRF MQDGFLGKAA YHASASGASS LQHEGLFQLR  240
NSKYLGPAQQ LLNEFCSLGT TKPTTADTQK QKPHKNKQWG EQEDNGSTSS SRNKQQSNIC  300
SLEFVELQKR KTRLLSMLEE VERRYKHYCD QMKAVVASFE AVAGAGAATV YSALAAKAMS  360
RHFRSLKDGI VSQIQATRKA MGEKDPVAPG TTRGETPRLR ILDQTLRQQR AFQQMNMMES  420
HPWRPQRGLP ERSVSVLRAW LFEHFLHPYP SDVDKHILAR QTGLSRSQAP YNNVSNWFIN  480
ARVRLWKPMV EEMYMEETKE RENNMNISNM TSSDGIATDP SPHQSRPEDE KPTHDQLVRM  540
DSECLSSIIT YPEKNHDSRG SKNTISSHNM HPHQNFGRVN ESFGTMELDF SSYNHHQQHS  600
GGTVSYANDH HHPSNQGFNA GGGVSLTLGL QQHGGNGVSL AFSPASQNSL FYPRDHIEEC  660
QPVQYSLLDG EGENNLPYRN LMGAQLLHDL AG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.154050.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008373687.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_008373620.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-141BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLM5WCS40.0M5WCS4_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s09720.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-119TALE family protein